Deutsch
РусскийEnglish
EUR
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 Artikel
Seltene Vintage Schatulle, Japan. Mit Jade inkrustiert.
Seltene Vintage Schatulle, Japan. Mit Jade inkrustiert.Seltene Vintage Schatulle, Japan. Mit Jade inkrustiert.Seltene Vintage Schatulle, Japan. Mit Jade inkrustiert.Seltene Vintage Schatulle, Japan. Mit Jade inkrustiert.Seltene Vintage Schatulle, Japan. Mit Jade inkrustiert.Seltene Vintage Schatulle, Japan. Mit Jade inkrustiert.Seltene Vintage Schatulle, Japan. Mit Jade inkrustiert.Seltene Vintage Schatulle, Japan. Mit Jade inkrustiert.Seltene Vintage Schatulle, Japan. Mit Jade inkrustiert.Seltene Vintage Schatulle, Japan. Mit Jade inkrustiert.
Seltene Vintage Schatulle, Japan. Mit Jade inkrustiert.
175,00 € inkl. MWSt.
Seltene Vintage Lack Schatulle, Japan. Mit Jade und Knochen inkrustiert. Top zustand. Datiert 10 Mai 1991
175,00 € inkl. MWSt.
Add to Cart
Product Code: AfLj61m
Product Condition: gebraucht
Einzelheiten
Related Products
Produkt in den Korb
x

-------- oder --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i